Mouse Anti-Rhesus NCBP2 Antibody (MO-AB-04603W)
Cat: MO-AB-04603W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO04603W |
Specificity | This antibody binds to Rhesus NCBP2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein has an RNP domain commonly found in RNA binding proteins, and contains the cap-binding activity. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus NCBP2 Antibody is a mouse antibody against NCBP2. It can be used for NCBP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Nuclear cap-binding protein subunit 2 isoform 2; NCBP2 |
UniProt ID | H9F156 |
Protein Refseq | The length of the protein is 49 amino acids long. The sequence is show below: MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSYAENAMRYIN. |
See other products for " NCBP2 "
MO-AB-59785W | Mouse Anti-Marmoset NCBP2 Antibody (MO-AB-59785W) |
MO-AB-23754W | Mouse Anti-Chimpanzee NCBP2 Antibody (MO-AB-23754W) |
CBMOAB-00111HCB | Mouse Anti-C. elegans NCBP2 Antibody (CBMOAB-00111HCB) |
MO-AB-27397H | Mouse Anti-Rat Ncbp2 Antibody (MO-AB-27397H) |
MO-AB-16421R | Mouse Anti-Cattle NCBP2 Antibody (MO-AB-16421R) |
MO-AB-03054Y | Mouse Anti-Chicken NCBP2 Antibody (MO-AB-03054Y) |
CBMOAB-88458FYA | Mouse Anti-Zebrafish ncbp2 Antibody (CBMOAB-88458FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry