Mouse Anti-Rhesus NR3C1 Antibody (CBMOAB-52949FYA)


Cat: CBMOAB-52949FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO52949FYA
SpecificityThis antibody binds to Rhesus NR3C1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175).
Product OverviewMouse Anti-Rhesus NR3C1 Antibody is a mouse antibody against NR3C1. It can be used for NR3C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNR3C1; NR3C1
UniProt IDA2D681
Protein RefseqThe length of the protein is 339 amino acids long.
The sequence is show below: LSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTKKEFPKTHSDGSSEQQNLKGHTGTNGGNVKLYTADQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPNNATLPQVKTEKEDFIELCTPGVIKQEKLGTVYCXXSFPGXNIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE.
For Research Use Only | Not For Clinical Use.
Online Inquiry