Mouse Anti-PPAPDC1B Antibody (CBMOAB-55071FYA)


Cat: CBMOAB-55071FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55071FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO55071FYA 100 µg
CBMOAB-93426FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO93426FYA 100 µg
MO-AB-17791W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17791W 100 µg
MO-AB-18300R Monoclonal Cattle (Bos taurus) WB, ELISA MO18300R 100 µg
MO-AB-62008W Monoclonal Marmoset WB, ELISA MO62008W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO55071FYA
SpecificityThis antibody binds to Rhesus PPAPDC1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PPAPDC1B Antibody is a mouse antibody against PPAPDC1B. It can be used for PPAPDC1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPPAPDC1B
UniProt IDF7FW46
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MWLYRNPYVEAEYFPTKPMFVIAFLSPLSLIFLAKFLKKADTRDSRQACLAASLALALNGVFTNTIKLIVGRPRPDFFYRCFPDGLAHSDLMCTGDKDVVNEGRKSFPSGHSSFAFAGLAFASLYLAGKLHCFTPQGRGKSWRFCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGITFAYVCYRQYYPPLTDAECHKPFQDKLALPTAQKKPGDSYCFDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry