AibGenesis™ Mouse Anti-PRR16 Antibody (CBMOAB-55437FYA)


Cat: CBMOAB-55437FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55437FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO55437FYA 100 µg
CBMOAB-94153FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94153FYA 100 µg
MO-AB-05371W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05371W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO55437FYA
SpecificityThis antibody binds to Rhesus PRR16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PRR16 Antibody is a mouse antibody against PRR16. It can be used for PRR16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProline-rich protein 16; PRR16
UniProt IDH9F627
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: DQIDTLTSDLQLEDEMTDSSKTDTLNSSSSGTTASSLEKIKVQANAPLIKPPAHPSAILTVLRKPNPPPPPPRLTPVKCEDLKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQPLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHNEPVHPPGKIPHQGPPLPPPPHLPPFPLENGGMGISHSNSFPPVRPATVPPPTAPKPQKTILRKSTTTTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry