AibGenesis™ Mouse Anti-PTPRO Antibody (CBMOAB-55737FYA)


Cat: CBMOAB-55737FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-55737FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO55737FYA 100 µg
CBMOAB-94678FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO94678FYA 100 µg
MO-AB-05440W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05440W 100 µg
MO-AB-09593Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09593Y 100 µg
MO-AB-62630W Monoclonal Marmoset WB, ELISA MO62630W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO55737FYA
SpecificityThis antibody binds to Rhesus PTPRO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus PTPRO Antibody is a mouse antibody against PTPRO. It can be used for PTPRO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPTPRO
UniProt IDF6YKI4
Protein RefseqThe length of the protein is 377 amino acids long.
The sequence is show below: LVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYENVSKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry