Mouse Anti-RHBDF1 Antibody (CBMOAB-56455FYA)


Cat: CBMOAB-56455FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56455FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO56455FYA 100 µg
CBMOAB-95887FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95887FYA 100 µg
MO-AB-05659W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05659W 100 µg
MO-AB-09681Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09681Y 100 µg
MO-AB-19259R Monoclonal Cattle (Bos taurus) WB, ELISA MO19259R 100 µg
MO-AB-23488W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23488W 100 µg
MO-AB-63271W Monoclonal Marmoset WB, ELISA MO63271W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO56455FYA
SpecificityThis antibody binds to Rhesus RHBDF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RHBDF1 Antibody is a mouse antibody against RHBDF1. It can be used for RHBDF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInactive rhomboid protein 1; RHBDF1
UniProt IDH9F7Q7
Protein RefseqThe length of the protein is 151 amino acids long.
The sequence is show below: LASAIFLPYRAEVGPAGSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFISGLFLSFAFLPYISFGKFDLYRKRCQIIIFQVVFLGLLAGLVVLFYFYPVRCEWCEFLTCIPFTDKFCEKYELDAQLH.
For Research Use Only | Not For Clinical Use.
Online Inquiry