AibGenesis™ Mouse Anti-TAS2R60 Antibody (CBMOAB-59757FYA)


Cat: CBMOAB-59757FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59757FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Gorilla, Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO59757FYA 100 µg
MO-AB-17867Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17867Y 100 µg
MO-AB-20785W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20785W 100 µg
MO-AB-30583R Monoclonal Pig (Sus scrofa) WB, ELISA MO30583R 100 µg
MO-AB-38777W Monoclonal Gorilla WB, ELISA MO38777W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Gorilla, Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO59757FYA
SpecificityThis antibody binds to Rhesus TAS2R60.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the bitter taste receptor family which belong to the G protein-coupled receptor superfamily and are predominantly expressed in taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encodes a seven-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered together with eight other taste receptor genes on chromosome 7. (From NCBI)
Product OverviewMouse Anti-Rhesus TAS2R60 Antibody is a mouse antibody against TAS2R60. It can be used for TAS2R60 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTaste receptor type 2; TAS2R60
UniProt IDF7HQL1
Protein RefseqThe length of the protein is 318 amino acids long.
The sequence is show below: MNGDHMVLGSSVTDQKAIILVIILLLLCLVAIAGNGFITAALGVEWVLRGTLLPCDKLLVSLRASRFCLQWVVMGKTIYVLLYPTAFPYNPVLQFLAFQWDFLNAATLWFSSWLSVFYCVKIATFTHPVFLWLKHKLSEWVPWMFFSSVGLSSFTTILFFIGNHSIYQNYLRNHLQPWNVTGNSIWSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHMEKALLTTSGFREPSVQAHVKALLALLSLAMLFISYFLSLVLSAAGIFPRLDFKFWVGESVIYLCAGVHPIILLFSNRRLRAVLERCRSSRCRTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry