Mouse Anti-Rice 10A19I.8 (clone MO18370FYB) Antibody (CBMOAB-18370FYB)


Cat: CBMOAB-18370FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18370FYB
SpecificityThis antibody binds to Rice 10A19I.8.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice 10A19I.8 (clone MO18370FYB) Antibody (CBMOAB-18370FYB) is a mouse antibody against 10A19I.8. It can be used for 10A19I.8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names10A19I.8; Putative uncharacterized protein OSJNBa0017N18.10; 10A19I.8; OSJNBa0017N18.10
UniProt IDQ9XHV8
Protein RefseqThe length of the protein is 236 amino acids long.
The sequence is show below: MAQQARAQWPQKQNKLFEQALAVYDKETPDRWHNIARAVGGGKSAEDVKRYYEMLEEDIKHIESGKVPFPAYRCPAAAGYQAESRPSTAAEPSRLPLSDSGLSGIRPTQYPPDGELSPPRHRLRRRGNQPIPSYKPSPSREGIFYWEVVVAALKSRGTGATSTPWIRLLLPGLTVCRLLGSSGCFDAWMLSTARLMVVNTYWMSYLTRSPEFHLNFPHINLRKYEVVCVQPGFMQE.
For Research Use Only | Not For Clinical Use.

Online Inquiry