Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rice 24K23.11 Antibody (CBMOAB-18382FYB)


Cat: CBMOAB-18382FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18382FYB
SpecificityThis antibody binds to Rice 24K23.11.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice 24K23.11 (clone MO18382FYB) Antibody (CBMOAB-18382FYB) is a mouse antibody against 24K23.11. It can be used for 24K23.11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOSJNBa0011F23.14 protein; OSJNBa0015K02.1 protein; Os04g0659000 protein; Putative uncharacterized protein 24K23.11; cDNA clone:001-111-B06, full insert sequence; 24K23.11; OSJNBa0011F23.14 OSJNBa0015K02.1; Os04g0659000
UniProt IDQ8S3P6
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MVIDQKLLCLVFVSGVLVLANLADVSSAAASSLSRQQDQVARVLGRRGRELIGEGLSGHQYRHEGKHKEQHEVVAMEATTKETAETKAGWVDDDEGAREGLIDSADYSGVAMHSPSPPKRKHPKKP.
For Research Use Only | Not For Clinical Use.

Online Inquiry