Mouse Anti-Rice 24K23.14 (clone MO18384FYB) Antibody (CBMOAB-18384FYB)


Cat: CBMOAB-18384FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18384FYB
SpecificityThis antibody binds to Rice 24K23.14.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice 24K23.14 (clone MO18384FYB) Antibody (CBMOAB-18384FYB) is a mouse antibody against 24K23.14. It can be used for 24K23.14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDUF26-like protein; OSJNBa0011F23.18 protein; OSJNBa0015K02.5 protein; Os04g0659300 protein; Putative receptor-like protein kinase; Receptor-like protein kinase; cDNA clone:006-211-C11, full insert sequence; 24K23.14; OSJNBa0011F23.18 OSJNBa0015K02.5; Os04g0659300
UniProt IDQ8S3P3
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MARCTLLVLLVAAAVAVVPLAAGQPWATCGDGTYEQGSAYENNLLNLALTLRDGASSQEILFSTGSNGAAPNTVYGLLLCRGDISRAACYDCGTSVWRDAGSACRRAKDVALVYNECYARLSDKDDFLADKVGPGQLTTLMSSTNISSGADVAAYDRAVTRLLAATAEYAAGDIARKLFATGQRVGADPGFPNLYATAQCAFDITLEACRGCLEGLVARWWDTFPANVDGARIAGPRCLLRSEVYPFYTGAPMVVLRE.
For Research Use Only | Not For Clinical Use.

Online Inquiry