Mouse Anti-Rice ACT7 Antibody (CBMOAB-18481FYB)


Cat: CBMOAB-18481FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18481FYB
SpecificityThis antibody binds to Rice ACT7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Product OverviewMouse Anti-Rice ACT7 (clone MO18481FYB) Antibody (CBMOAB-18481FYB) is a mouse antibody against ACT7. It can be used for ACT7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-7; ACT7; AC7 RAC7; Os01g0866100 LOC_Os01g64630
UniProt IDP0C540
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MAEEDIQPIVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKANREKMTQIMFETFNCPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFTLPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDYEQELDTARSSSSIEKSYELPDGQVITIGAERFRCPEVLFQPSFIGMEAPGIHEATYNSIMKCDVDIRKDLYGNVVLSGGSTMFPGIGDRMSKEITALAPGSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWISKAEYDESGPGIVHMKCF.

See other products for " ACT7 "

For Research Use Only | Not For Clinical Use.

Online Inquiry