Mouse Anti-Rice Actin Antibody (CBMOAB-18482FYB)


Cat: CBMOAB-18482FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18482FYB
SpecificityThis antibody binds to Rice Actin.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice Actin (clone MO18482FYB) Antibody (CBMOAB-18482FYB) is a mouse antibody against Actin. It can be used for Actin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin
UniProt IDC7DQF0
Protein RefseqThe length of the protein is 34 amino acids long.
The sequence is show below: PHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE.

See other products for " Actin "

CBMOAB-00296FYARabbit Anti-Mouse Actin Antibody (CBMOAB-00296FYA)
CBMOAB-00291FYARabbit Anti-Mouse Actin Antibody (CBMOAB-00291FYA)
MO-DKB-03601WRabbit Anti-Actin (AA 50-150, clone ms2109-009) Antibody (Cat MO-DKB-03601W)
MO-DKB-03974WRabbit Anti-ACTIN (C-terminal) Antibody (Cat MO-DKB-03974W)
MO-AB-70552WMouse Anti-A. thaliana Actin Antibody (MO-AB-70552W)
MO-DKB-03600WRabbit Anti-Actin (Full length, clone ms2109-008) Antibody (Cat MO-DKB-03600W)
MO-AB-28233WMouse Anti-Cucumber actin Antibody (MO-AB-28233W)
MO-DKB-03887WMouse Anti-Actin Antibody (Cat MO-DKB-03887W)
MO-MMB-0003Mouse Anti-Actin Antibody (Cat MO-MMB-0003)
MO-DKB-01765WRabbit Anti-Actin Antibody (MO-DKB-01765W)
For Research Use Only | Not For Clinical Use.

Online Inquiry