Mouse Anti-Rice Actin Antibody (CBMOAB-18482FYB)
Cat: CBMOAB-18482FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rice (Oryza) |
Clone | MO18482FYB |
Specificity | This antibody binds to Rice Actin. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Actin is a family of globular multi-functional proteins that form microfilaments. It is found in essentially all eukaryotic cells (the only known exception being nematode sperm), where it may be present at a concentration of over 100 μM; its mass is roughly 42-kDa, with a diameter of 4 to 7 nm. |
Product Overview | Mouse Anti-Rice Actin Antibody is a mouse antibody against Actin. It can be used for Actin detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Actin |
UniProt ID | C7DQF0 |
Protein Refseq | The length of the protein is 34 amino acids long. The sequence is show below: PHAILRLDLAGRDLTDYLMKILTERGYSFTTTAE. |
See other products for " actin "
MO-AB-28233W | Mouse Anti-Cucumber actin Antibody (MO-AB-28233W) |
MO-DKB-03887W | Mouse Anti-Actin Antibody (Cat MO-DKB-03887W) |
MO-DKB-03601W | Rabbit Anti-Actin (AA 50-150, clone ms2109-009) Antibody (Cat MO-DKB-03601W) |
MO-DKB-03600W | Rabbit Anti-Actin (Full length, clone ms2109-008) Antibody (Cat MO-DKB-03600W) |
MO-MMB-0003 | Mouse Anti-Actin Antibody (Cat MO-MMB-0003) |
MO-DKB-01765W | Rabbit Anti-Actin Antibody (MO-DKB-01765W) |
CBMOAB-00291FYA | Rabbit Anti-Mouse Actin Antibody (CBMOAB-00291FYA) |
MO-DKB-03974W | Rabbit Anti-ACTIN (C-terminal) Antibody (Cat MO-DKB-03974W) |
MO-AB-70552W | Mouse Anti-A. thaliana Actin Antibody (MO-AB-70552W) |
CBMOAB-00296FYA | Rabbit Anti-Mouse Actin Antibody (CBMOAB-00296FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry