Mouse Anti-Rice ADF1 Antibody (CBMOAB-18491FYB)


Cat: CBMOAB-18491FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18491FYB
SpecificityThis antibody binds to Rice ADF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity).
Product OverviewMouse Anti-Rice ADF1 Antibody is a mouse antibody against ADF1. It can be used for ADF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin-depolymerizing factor 1; ADF-1; OsADF1; ADF1; Os02g0663800 LOC_Os02g44470
UniProt IDQ6EUH7
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACLPADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSMDIVKSRAL.

Reference

See other products for " Adf1 "

CBMOAB-00717FYAMouse Anti-D. melanogaster Adf1 Antibody (CBMOAB-00717FYA)
CBMOAB-1643FYCMouse Anti-Arabidopsis ADF1 Antibody (CBMOAB-1643FYC)
CBMOAB-00127CRMouse Anti-Yeast ADF1 Antibody (CBMOAB-00127CR)
CBMOAB-1642FYCMouse Anti-Arabidopsis ADF1 Antibody (CBMOAB-1642FYC)
For Research Use Only | Not For Clinical Use.

Online Inquiry