Mouse Anti-Rice adh1 Antibody (CBMOAB-18506FYB)


Cat: CBMOAB-18506FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18506FYB
SpecificityThis antibody binds to Rice adh1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlcohol dehydrogenase mostly active on ethanol (EtOH), but exhibits broad substrates selectivity for primary and secondary alcohols (e.g. butanol, propyl alcohol, pentanol, isopentanol, ethylene glycol, isopropanol, methanol and tertiary butyl alcohol) (PubMed:23707506). Converts allyl alcohol to highly toxic acryl-aldehyde (PubMed:20508152). Required for survival and acclimation in hypoxic conditions, especially in roots (PubMed:12857811, PubMed:9880346).
Product OverviewMouse Anti-Rice adh1 Antibody is a mouse antibody against adh1. It can be used for adh1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADH1
UniProt IDD7PPI1
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: MATAGKVIKCKXXXXXXXXXXXXIEEVEVAPPQAMEVRVKILFTXXXXXXXXFWEAKGQTPVFPRIFGHEAGGIVESVGEGVTDLAPGDHVLPVFTGECKECAHCKSAESNMCDLLRINTDRGVMIGDGKSRFXXXXXXXYHFVGTSTFSEYTVMHVGCVAKINPAAPLDKVCVLSCGISTGLGATINVAKPPKGSTVAIFGLGAVGLAAAEGARIAGASRIIGIDLNANRFEEARKFGCTEFVNPKDHDKPVQQVLAEMTNGGVDRSVECTGNINAMIQAFECVHDGWGVAVLVGVPHKDAEFKTHPMNFLNERXLKGTFFGNYKPRTDLPNVVELYMKKELEVEKFXXXXVPFSEINTAFDLMHKGEGIRCIIRMEN.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry