Mouse Anti-Rice ADIPOR1 Antibody (CBMOAB-18521FYB)


Cat: CBMOAB-18521FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18521FYB
SpecificityThis antibody binds to Rice ADIPOR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rice ADIPOR1 Antibody is a mouse antibody against ADIPOR1. It can be used for ADIPOR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeptahelical transmembrane protein ADIPOR1; PAQR family protein ADIPOR1; ADIPOR1; Os06g0643700 LOC_Os06g43620
UniProt IDB7F9G7
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MGEEAAMATMESAYHDELAPAAAPAPAKGGGSKKKRKQQKREEKRKECRLVSYHELPDYMKENEFILDYYRSEWPILNALLSLFSWHNETINIWTHLLGFVLFFGLTVLHLGQYFPQVADLIGHLSWPISKVAENVSSNIGDVLSGAASFMQASPASSAGAMAAAWPVTAAAAATTRWPFFVFLAGAMFCLLSSAACHLLSCHSHRLNLFLIRLDYTGIAVMIVVSFFPPIYYIFQCEPRWQVVYLSAITAAGVATVYALMSPRLSAARYRAHRALLFVAMGLSGVVPAAHAVAVNWHEPRRNVTLAYEGAMAASYLAGTAFYLTRVPERWRPGMFDLCGHSHQIFHALVIAGALAHYAAAIVFIQARDEMGCPAP.
See other products for " ADIPOR1 "
MO-DKB-00943WRabbit Anti-ADIPOR1 Antibody (MO-DKB-00943W)
MO-AB-07093YMouse Anti-Rabbit AdipoR1 Antibody (MO-AB-07093Y)
MO-AB-34336WMouse Anti-Ferret ADIPOR1 Antibody (MO-AB-34336W)
MOFY-1222-FY124Rabbit Anti-ADIPOR1 Antibody (MOFY-1222-FY124)
MO-AB-36673WMouse Anti-Goat AdipoR1 Antibody (MO-AB-36673W)
MOFY-0722-FY94Rabbit Anti-ADIPOR1 Antibody (MOFY-0722-FY94)
MO-AB-07054RMouse Anti-Cattle ADIPOR1 Antibody (MO-AB-07054R)
MO-AB-01257HMouse Anti-Frog adipor1 Antibody (MO-AB-01257H)
MO-AB-00057YMouse Anti-Chicken ADIPOR1 Antibody (MO-AB-00057Y)
MO-NAB-00383WRabbit Anti-ADIPOR1 Antibody (N-terminal)
For Research Use Only | Not For Clinical Use.
Online Inquiry