Mouse Anti-Rice MADS7 (clone MO18340FYB) Antibody (CBMOAB-18340FYB)


Cat: CBMOAB-18340FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18340FYB
SpecificityThis antibody binds to Rice MADS7.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor. May be involved in the control of flowering time.
Product OverviewMouse Anti-Rice MADS7 (clone MO18340FYB) Antibody (CBMOAB-18340FYB) is a mouse antibody against MADS7. It can be used for MADS7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMADS-box transcription factor 7; FDRMADS1; MADS-box protein 45; OsMADS45; OsMADS7; Protein AGAMOUS-like 6; RMADS216; MADS7; AGL6 M79 MADS45; Os08g0531700 LOC_Os08g41950
UniProt IDQ0J466
Protein RefseqThe length of the protein is 249 amino acids long.
The sequence is show below: MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSTQSMTKTLEKYQKCSYAGPETAVQNRESEQLKASRNEYLKLKARVENLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDQLTELQRKEQMVSEANRCLRRKLEESNHVRGQQVWEQGCNLIGYERQPEVQQPLHGGNGFFHPLDAAGEPTLQIGYPAEHHEAMNSACMNTYMPPWLP.
For Research Use Only | Not For Clinical Use.

Online Inquiry