Mouse Anti-Rice ndhH Antibody (CBMOAB-34962FYB)


Cat: CBMOAB-34962FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO34962FYB
SpecificityThis antibody binds to Rice ndhH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.
Product OverviewMouse Anti-Rice ndhH Antibody is a mouse antibody against ndhH. It can be used for ndhH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAD(P)H-quinone oxidoreductase subunit H, chloroplastic; EC 1.6.5.-; NAD(P)H dehydrogenase subunit H; NADH-plastoquinone oxidoreductase 49 kDa subunit; NADH-plastoquinone oxidoreductase subunit H; ndhH; LOC_Osp1g00970
UniProt IDP0C337
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MSLPLTRKDLMIVNMGPQHPSMHGVLRLIVTLDGEDVIDCEPILGYLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITVNAPEFLENIQIPQRASYIRVIMLELSRIASHLLWLGPFMADLGAQTPFFYIFRERELIYDLFEAATGMRMMHNYFRIGGVAADLPYGWIDKCLDFCDYFLRGVIEYQQLITQNPIFLERVEGVGFISGEEAVNWGLSGPMLRASGIQWDLRKVDLYESYNQFDWKVQWQKEGDSLARYLVRIGEMRESIKIIQQAVEKIPGGPYENLEVRRFKKAKNSEWNDFEYRFLGKKPSPNFELSKQELYARVEAPKGELGIYLVGDDSLFPWRWKIRPPGFINLQILPQLVKKMKLADIMTILGSIDIIMGEVDR.
See other products for " ndhH "
MO-AB-00719HMouse Anti-Arabidopsis ndhH Antibody (MO-AB-00719H)
MO-DKB-03048WRabbit Anti-NDHH Antibody (MO-DKB-03048W)
MO-DKB-0343RARabbit Anti-NdhH Antibody (MO-DKB-0343RA)
MO-AB-00382WMouse Anti-Barrel medic ndhH Antibody (MO-AB-00382W)
CBMOAB-37241FYCMouse Anti-Arabidopsis NDHH Antibody (CBMOAB-37241FYC)
MO-AB-30324HMouse Anti-Sugar beet ndhH Antibody (MO-AB-30324H)
MOFAB-271WArabidopsis NdhH Antibody (MOFAB-271W)
For Research Use Only | Not For Clinical Use.
Online Inquiry