Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Rice OJ1371_D04.6 Antibody (CBMOAB-18341FYB)


Cat: CBMOAB-18341FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18341FYB
SpecificityThis antibody binds to Rice OJ1371_D04.6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationVacuole; Extracellular region or secreted; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice OJ1371_D04.6 (clone MO18341FYB) Antibody (CBMOAB-18341FYB) is a mouse antibody against OJ1371_D04.6. It can be used for OJ1371_D04.6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOs02g0469600 protein; Putative cysteine proteinase 1; cDNA clone:J013002F17, full insert sequence; cDNA clone:J013063O07, full insert sequence; cDNA clone:J023020I09, full insert sequence; OJ1371_D04.6; Os02g0469600
UniProt IDQ6K7A3
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MDHRLLLLGLLLLSPAVAAASVPGEEEPLIRQVVGGGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRAYLGLRTSRRAFLRGLGGSAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLATGKMDVLSEQQMVDCDHECDSSEPDSCDAGCNGGLMTNAFSYLLKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLAIGINAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHTSKE.
For Research Use Only | Not For Clinical Use.

Online Inquiry