Mouse Anti-Rice OJ1371_D04.6 (clone MO18341FYB) Antibody (CBMOAB-18341FYB)


Cat: CBMOAB-18341FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18341FYB
SpecificityThis antibody binds to Rice OJ1371_D04.6.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationVacuole; Extracellular region or secreted; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice OJ1371_D04.6 (clone MO18341FYB) Antibody (CBMOAB-18341FYB) is a mouse antibody against OJ1371_D04.6. It can be used for OJ1371_D04.6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOs02g0469600 protein; Putative cysteine proteinase 1; cDNA clone:J013002F17, full insert sequence; cDNA clone:J013063O07, full insert sequence; cDNA clone:J023020I09, full insert sequence; OJ1371_D04.6; Os02g0469600
UniProt IDQ6K7A3
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MDHRLLLLGLLLLSPAVAAASVPGEEEPLIRQVVGGGDDNELELNAERHFASFVQRFGKSYRDADEHAYRLSVFKANLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRAYLGLRTSRRAFLRGLGGSAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGANYLATGKMDVLSEQQMVDCDHECDSSEPDSCDAGCNGGLMTNAFSYLLKSGGLESEKDYPYTGRDGTCKFDKSKIVTSVQNFSVVSVDEDQIAANLVKHGPLAIGINAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGASGFAPIRLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHTSKE.
For Research Use Only | Not For Clinical Use.

Online Inquiry