Mouse Anti-Rice OS9 Antibody (CBMOAB-56603FYB)


Cat: CBMOAB-56603FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO56603FYB
SpecificityThis antibody binds to Rice OS9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is highly expressed in osteosarcomas. This protein binds to the hypoxia-inducible factor 1 (HIF-1), a key regulator of the hypoxic response and angiogenesis, and promotes the degradation of one of its subunits. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product OverviewMouse Anti-Rice OS9 Antibody is a mouse antibody against OS9. It can be used for OS9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein OS-9 homolog; OsOS9; OS9; Os06g0644800 LOC_Os06g43710
UniProt IDQ67WM9
Protein RefseqThe length of the protein is 298 amino acids long.
The sequence is show below: MGLAGGARVVLFVVAAAAAAALTAAADQIFTSSGAPFGRNSREPRYHVEFHPVDAPFNPENGQESVPMTSHVGKHYTCFLPVEETKTMKSIIPQNATNVIIESERRVKPKDPDELLEILKDQCFYRHEGWWSYEFCYYGKIRQVHVEGEKVIQEYVLGEYDADATDAYYENQTSDSADEDDNLIDTSKRYHVHLYTNGTVCDLTDMPRETEVRFVCSEPTVVISSIKEISSCKYVLTVQSPMLCKNPLFQQEKRTLSIHCNELLAEAEATVDDDSLPKEAQIIIPDPDGLHNYAAYAT.
See other products for " OS9 "
CBMOAB-53596FYAMouse Anti-Rhesus OS9 Antibody (CBMOAB-53596FYA)
MO-AB-10593WMouse Anti-Chimpanzee OS9 Antibody (MO-AB-10593W)
MO-DKB-02372WRabbit Anti-OS9 Antibody (MO-DKB-02372W)
CBMOAB-90973FYAMouse Anti-Zebrafish os9 Antibody (CBMOAB-90973FYA)
MO-AB-17353RMouse Anti-Cattle OS9 Antibody (MO-AB-17353R)
CBMOAB-37879FYCMouse Anti-Arabidopsis OS9 Antibody (CBMOAB-37879FYC)
MO-AB-04923WMouse Anti-Rhesus OS9 Antibody (MO-AB-04923W)
MO-AB-45936WMouse Anti-Horse OS9 Antibody (MO-AB-45936W)
CBMOAB-26995FYAMouse Anti-D. melanogaster Os9 Antibody (CBMOAB-26995FYA)
MO-DKB-00321WRabbit Anti-OS9 Antibody (MO-DKB-00321W)
For Research Use Only | Not For Clinical Use.
Online Inquiry