Mouse Anti-Rice OSJNBb0019B14.24 (clone MO18348FYB) Antibody (CBMOAB-18348FYB)


Cat: CBMOAB-18348FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18348FYB
SpecificityThis antibody binds to Rice OSJNBb0019B14.24.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReversible hydration of carbon dioxide.
Product OverviewMouse Anti-Rice OSJNBb0019B14.24 (clone MO18348FYB) Antibody (CBMOAB-18348FYB) is a mouse antibody against OSJNBb0019B14.24. It can be used for OSJNBb0019B14.24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbonic anhydrase; EC 4.2.1.1; OSJNBb0019B14.24; Os09g0464000
UniProt IDQ69MC9
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MAPSLLRPASPCLNLAPPTADGPGRSRSAVTIGGSRPLSVSLRVGGSSRRDFPCTTMASRDHSGLTRQLLDFQHGTVDEIDGEHDPFMELKARFMDFKHRNCVDNISNYQNLAQQQTPKFMVVACADSRVCPSSVLGFQPGEAFTVRNIANLVPPYQHGASETSAALEFAVNTLEVENVLVVGHSRCGGIQALMSMKSKQDDSQSRSFIRDWVSIAKSARLSTEAAAGNLNFELQCKHCEKESINSSLLNLLTYPWIEKRVNEGTLSLHGGYYNFIDCTFEKWKLVYRQGLEGGSKYAIKNRTTWS.
For Research Use Only | Not For Clinical Use.

Online Inquiry