Mouse Anti-Rice P0623F08.44 (clone MO18354FYB) Antibody (CBMOAB-18354FYB)


Cat: CBMOAB-18354FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO18354FYB
SpecificityThis antibody binds to Rice P0623F08.44.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice P0623F08.44 (clone MO18354FYB) Antibody (CBMOAB-18354FYB) is a mouse antibody against P0623F08.44. It can be used for P0623F08.44 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOs08g0545800 protein; Putative uncharacterized protein OJ1323_A06.11; Putative uncharacterized protein P0623F08.44; cDNA clone:002-156-A05, full insert sequence; P0623F08.44; OJ1323_A06.11; Os08g0545800
UniProt IDQ6ZBG6
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MEIKLVFFFLLLLGFGNAEEELDTETCDVAKLSAEIGTYCEFDQGRMYPGRCCDSIIDAADGHDGGGTQCICRVWMEDAVRKTGITFRELLHKYIDCGGLQPSLPHLADSACSAAPEMVGTLPGPGKISGADTTNVGVIFSAMRPAIIVNKMLAST.
For Research Use Only | Not For Clinical Use.

Online Inquiry