Mouse Anti-Rice TK Antibody (CBMOAB-89678FYB)


Cat: CBMOAB-89678FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO89678FYB
SpecificityThis antibody binds to Rice TK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Stimulates gut muscle contractions (PubMed:10801863). Required for the response to the male sex pheromone CH503 which is transferred from males to females during mating and inhibits courtship behavior by other males (PubMed:26083710). The Gr68a gustatory receptor is required for detection of the pheromone and Gr68a-expressing neurons in the male foreleg relay signals to the suboesophageal zone (SEZ) which leads to courtship suppression through release of tachykinin from a cluster of 8-10 neurons in the SEZ (PubMed:26083710).
Product OverviewMouse Anti-Rice TK Antibody is a mouse antibody against TK. It can be used for TK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThymidine kinase; EC 2.7.1.21; TK; Os03g0113100 LOC_Os03g02200
UniProt IDO81263
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: MRSLLAASTFLRSGASPLLRPLSRPLPSRLNLSRFGPVRPVSAAAAAADKSRGGGGSAMEAQPSYPGEIHVIVGPMFAGKTTALLRRVQVEAGTGSRNVALIKSDKDNRYGLDSVVTHDGTKMPCWALPELSSFQDKLGTEAYDKVDVIGIDEAQFFDDLHDFCCKAADRDGKIVVVAGLDGDYKRNKFGSVLDIIPLADSVTKLTARCELCGRRAFFTLRKTRETKTELIGGADVYMPVCRQHYLDGQIVIEATRIVLDLEKSKVIHAFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry