Mouse Anti-RPL15 Antibody (CBMOAB-40353FYC)
Cat: CBMOAB-40353FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40353FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO40353FC | 100 µg | ||
| CBMOAB-29967FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO29967FYA | 100 µg | ||
| CBMOAB-96401FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96401FYA | 100 µg | ||
| CBMOAB-09291HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO09291HB | 100 µg | ||
| MO-AB-08423W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08423W | 100 µg | ||
| MO-AB-17463W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17463W | 100 µg | ||
| MO-AB-33129W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33129W | 100 µg | ||
| MO-AB-38121W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38121W | 100 µg | ||
| MO-AB-38732W | Monoclonal | Gorilla | WB, ELISA | MO38732W | 100 µg | ||
| MO-AB-46361W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46361W | 100 µg | ||
| MO-AB-70302W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70302W | 100 µg | ||
| MO-AB-19482R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19482R | 100 µg | ||
| MO-AB-07224H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07224C | 100 µg | ||
| MO-AB-28594H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28594C | 100 µg | ||
| MO-AB-33729H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33729C | 100 µg | ||
| MO-AB-03848Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03848Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO40353FC |
| Specificity | This antibody binds to Arabidopsis RPL15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Chloroplast; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L15E family of ribosomal proteins and a component of the 60S subunit. This gene shares sequence similarity with the yeast ribosomal protein YL10 gene. Elevated expression of this gene has been observed in esophageal tumors and gastric cancer tissues, and deletion of this gene has been observed in a Diamond-Blackfan anemia (DBA) patient. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Product Overview | Mouse Anti-Arabidopsis RPL15 Antibody is a mouse antibody against RPL15. It can be used for RPL15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribosomal Protein L15; Large Ribosomal Subunit Protein EL15; EC45; 0S Ribosomal Protein L15; RPLY10; RPYL10; DBA12; RPL10; L15 |
| UniProt ID | P25873 |
| Protein Refseq | The length of the protein is 277 amino acids long. The sequence is show below: MATPLSISSNPLTSRHCYRLHLSSTSFKGNVSVLGANPSQILSLKLNQTLKTRNQQQFARPLVVVSQTAATSSAVVAPERFRLDNLGPQPGSRKKQKRKGRGISAGQGASCGFGMRGQKSRSGPGIMRGFEGGQTALYRRLPKLRGIAGGMRSGLPKYLPVNIKDIETAGFQEGDEVSLETLKQKGLINPSGRERKLPLKILGTGELSMKLTFKARAFSTQAKEKLEASGCTLTVLPGRKKWVKPSVAKNQARADEYFAKKRAAAAEAATSEPAASA. |
See other products for " RPL15 "
| MO-AB-09755Y | Mouse Anti-RPL15 Antibody (MO-AB-09755Y) |
| MO-AB-63515W | Mouse Anti-RPL15 Antibody (MO-AB-63515W) |
| MO-AB-01278L | Mouse Anti-RPL15 Antibody (MO-AB-01278L) |
For Research Use Only | Not For Clinical Use.
Online Inquiry