Mouse Anti-RPL15 Antibody (CBMOAB-40353FYC)


Cat: CBMOAB-40353FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40353FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio) WB, ELISA MO40353FC 100 µg
CBMOAB-29967FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO29967FYA 100 µg
CBMOAB-96401FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96401FYA 100 µg
CBMOAB-09291HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO09291HB 100 µg
MO-AB-08423W Monoclonal Cat (Felis catus) WB, ELISA MO08423W 100 µg
MO-AB-17463W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17463W 100 µg
MO-AB-33129W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33129W 100 µg
MO-AB-38121W Monoclonal Goat (Capra hircus) WB, ELISA MO38121W 100 µg
MO-AB-38732W Monoclonal Gorilla WB, ELISA MO38732W 100 µg
MO-AB-46361W Monoclonal Horse (Equus caballus) WB, ELISA MO46361W 100 µg
MO-AB-70302W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70302W 100 µg
MO-AB-19482R Monoclonal Cattle (Bos taurus) WB, ELISA MO19482R 100 µg
MO-AB-07224H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07224C 100 µg
MO-AB-28594H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28594C 100 µg
MO-AB-33729H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33729C 100 µg
MO-AB-03848Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03848Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Goat (Capra hircus), Gorilla, Horse (Equus caballus), Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus), Silkworm (Bombyx mori), Zebrafish (Danio rerio)
CloneMO40353FC
SpecificityThis antibody binds to Arabidopsis RPL15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Chloroplast; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of four RNA species and approximately 80 structurally distinct proteins. This gene encodes a member of the L15E family of ribosomal proteins and a component of the 60S subunit. This gene shares sequence similarity with the yeast ribosomal protein YL10 gene. Elevated expression of this gene has been observed in esophageal tumors and gastric cancer tissues, and deletion of this gene has been observed in a Diamond-Blackfan anemia (DBA) patient. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-Arabidopsis RPL15 Antibody is a mouse antibody against RPL15. It can be used for RPL15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal Protein L15; Large Ribosomal Subunit Protein EL15; EC45; 0S Ribosomal Protein L15; RPLY10; RPYL10; DBA12; RPL10; L15
UniProt IDP25873
Protein RefseqThe length of the protein is 277 amino acids long. The sequence is show below: MATPLSISSNPLTSRHCYRLHLSSTSFKGNVSVLGANPSQILSLKLNQTLKTRNQQQFARPLVVVSQTAATSSAVVAPERFRLDNLGPQPGSRKKQKRKGRGISAGQGASCGFGMRGQKSRSGPGIMRGFEGGQTALYRRLPKLRGIAGGMRSGLPKYLPVNIKDIETAGFQEGDEVSLETLKQKGLINPSGRERKLPLKILGTGELSMKLTFKARAFSTQAKEKLEASGCTLTVLPGRKKWVKPSVAKNQARADEYFAKKRAAAAEAATSEPAASA.
For Research Use Only | Not For Clinical Use.
Online Inquiry