Mouse Anti-Rplp2 Antibody (CBMOAB-30051FYA)


Cat: CBMOAB-30051FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30051FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO30051FYA 100 µg
CBMOAB-56784FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56784FYA 100 µg
CBMOAB-96472FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96472FYA 100 µg
MO-AB-07264H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07264C 100 µg
MO-AB-09762Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09762Y 100 µg
MO-AB-19532R Monoclonal Cattle (Bos taurus) WB, ELISA MO19532R 100 µg
MO-AB-28638H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28638C 100 µg
MO-AB-28862R Monoclonal Pig (Sus scrofa) WB, ELISA MO28862R 100 µg
MO-AB-46374W Monoclonal Horse (Equus caballus) WB, ELISA MO46374W 100 µg
MO-AB-63545W Monoclonal Marmoset WB, ELISA MO63545W 100 µg
MO-DKB-01112W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO30051FYA
SpecificityThis antibody binds to fruit fly Rplp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-D. melanogaster Rplp2 Antibody is a mouse antibody against Rplp2. It can be used for Rplp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S acidic ribosomal protein P2; Acidic ribosomal protein RPA1; RpLP2; rpA1 RpP1
UniProt IDP05389
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE.
For Research Use Only | Not For Clinical Use.
Online Inquiry