Mouse Anti-Rplp2 Antibody (CBMOAB-30051FYA)
Cat: CBMOAB-30051FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-30051FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) | WB, ELISA | MO30051FYA | 100 µg | ||
CBMOAB-56784FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56784FYA | 100 µg | ||
CBMOAB-96472FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96472FYA | 100 µg | ||
MO-AB-07264H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07264C | 100 µg | ||
MO-AB-09762Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09762Y | 100 µg | ||
MO-AB-19532R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19532R | 100 µg | ||
MO-AB-28638H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28638C | 100 µg | ||
MO-AB-28862R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28862R | 100 µg | ||
MO-AB-46374W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46374W | 100 µg | ||
MO-AB-63545W | Monoclonal | Marmoset | WB, ELISA | MO63545W | 100 µg | ||
MO-DKB-01112W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
Clone | MO30051FYA |
Specificity | This antibody binds to fruit fly Rplp2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-D. melanogaster Rplp2 Antibody is a mouse antibody against Rplp2. It can be used for Rplp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 60S acidic ribosomal protein P2; Acidic ribosomal protein RPA1; RpLP2; rpA1 RpP1 |
UniProt ID | P05389 |
Protein Refseq | The length of the protein is 113 amino acids long. The sequence is show below: MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGKSIDDLIKEGREKLSSMPVGGGGAVAAADAAPAAAAGGDKKEAKKEEKKEESESEDDDMGFALFE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry