AibGenesis™ Mouse Anti-Rspo1 Antibody (MO-AB-13131Y)
Cat: MO-AB-13131Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-13131Y | Monoclonal | O. mykiss (Oncorhynchus mykiss), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO13131Y | 100 µg | ||
| CBMOAB-56917FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56917FYA | 100 µg | ||
| CBMOAB-96716FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96716FYA | 100 µg | ||
| MO-AB-33185W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33185W | 100 µg | ||
| MO-AB-35614W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35614W | 100 µg | ||
| MO-AB-38136W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38136W | 100 µg | ||
| MO-AB-46399W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46399W | 100 µg | ||
| MO-AB-03871Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03871Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. mykiss (Oncorhynchus mykiss), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO13131Y |
| Specificity | This antibody binds to O. mykiss Rspo1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | This product is a mouse antibody against Rspo1. It can be used for Rspo1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | R-spondin-like protein; rspo1 |
| UniProt ID | G8GVE3 |
| Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: MQLGLVALAMVFLGSMGHSDSGLKLSKGQRQRRISTEGPPSCSNGCERCSEYNGCIKCKPKLFILLE. |
See other products for " RSPO1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry