Mouse Anti-RSPO1 Antibody (MO-AB-19631R)


Cat: MO-AB-19631R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19631R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO19631R 100 µg
CBMOAB-56917FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56917FYA 100 µg
CBMOAB-96716FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96716FYA 100 µg
MO-AB-33185W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33185W 100 µg
MO-AB-35614W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35614W 100 µg
MO-AB-38136W Monoclonal Goat (Capra hircus) WB, ELISA MO38136W 100 µg
MO-AB-46399W Monoclonal Horse (Equus caballus) WB, ELISA MO46399W 100 µg
MO-AB-03871Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03871Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Goat (Capra hircus), Horse (Equus caballus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO19631R
SpecificityThis antibody binds to Cattle RSPO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against RSPO1. It can be used for RSPO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRSPO1 protein; RSPO1
UniProt IDA7YY21
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MRLGLCVVALVLSWMHLAAGSRGIKGKRQRRISADGGQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQESLYLHKGRCYPACPEGSAPADGTMECSSPAQCEMSEWSLWGPCSKKKKLCGFRRGLEERTRRVLHAPGGDHAVCSDTKETRKCTVRRTPCPEGQKRRKGSQGRRENANRNPGHKESKEAGTGARRRKGQQQQQQGTEGP.
See other products for " Rspo1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry