AibGenesis™ Mouse Anti-RSPO3 Antibody (MO-AB-19633R)


Cat: MO-AB-19633R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19633R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO19633R 100 µg
CBMOAB-56922FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56922FYA 100 µg
CBMOAB-96720FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96720FYA 100 µg
CBMOAB-61328FYC Monoclonal Zebrafish (Danio rerio) WB, ELISA MO61328FYC 100 µg
MO-AB-18618W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18618W 100 µg
MO-AB-38139W Monoclonal Goat (Capra hircus) WB, ELISA MO38139W 100 µg
MO-AB-63654W Monoclonal Marmoset WB, ELISA MO63654W 100 µg
MO-AB-28894R Monoclonal Pig (Sus scrofa) WB, ELISA MO28894R 100 µg
MO-AB-03873Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03873Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO19633R
SpecificityThis antibody binds to Cattle RSPO3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development. (From NCBI)
Product OverviewThis product is a mouse antibody against RSPO3. It can be used for RSPO3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesR-spondin-3; Roof plate-specific spondin-3; RSPO3
UniProt IDQ1RMU1
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: MHLRLISWFFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPKLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEASEWSPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTSEARKCTVQRKKCPKGERGRKGRERKRKKPNKEESKDAIPDNKGLEPSRETPEQRENKQQQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry