Mouse Anti-RSU1 Antibody (CBMOAB-00132HCB)
Cat: CBMOAB-00132HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00132HCB | Monoclonal | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO00132HB | 100 µg | ||
| CBMOAB-56930FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56930FYA | 100 µg | ||
| CBMOAB-96735FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96735FYA | 100 µg | ||
| MO-AB-07340H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07340C | 100 µg | ||
| MO-AB-17531Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17531Y | 100 µg | ||
| MO-AB-19638R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19638R | 100 µg | ||
| MO-AB-23694H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23694C | 100 µg | ||
| MO-AB-24047W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24047W | 100 µg | ||
| MO-AB-46403W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46403W | 100 µg | ||
| MO-AB-63661W | Monoclonal | Marmoset | WB, ELISA | MO63661W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO00132HB |
| Specificity | This antibody binds to C. elegans RSU1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. |
| Product Overview | Mouse Anti-C. elegans RSU1 Antibody is a mouse antibody against RSU1. It can be used for RSU1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein RSU-1; rsu-1 |
| Gene ID | 175451 |
| UniProt ID | Q09497 |
| Protein Refseq | The length of the protein is 268 amino acids long. The sequence is show below: MPKDKKKDEVTEVEHVDRNISSFSQISHLIDAEIITRLTLSHNKLTSVPPNIADLVSLQSLNLWNNQIEDLPPSISSLPKLRILNVGMNKLSILPRGFGSFPELEILDLTYNNLSERSLPGNFFFMQTLRALYLGDNDFEMLPGDVENLTNLQILVLRENDLLTLPKELGKLTRLRELHIQGNRLAMIPPELGNLELVGSKQVLRLEHNPFIPRIEEQFEANGAAGVWAHIRTDDYRYFFGRQEPSSTPVPPKRNKEKKVSRKGIQQA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry