Mouse Anti-S100A11 Antibody (CBMOAB-57034FYA)
Cat: CBMOAB-57034FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-57034FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO57034FYA | 100 µg | ||
MO-AB-01310L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01310L | 100 µg | ||
MO-AB-07326W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07326W | 100 µg | ||
MO-AB-07389H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07389C | 100 µg | ||
MO-AB-09808Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09808Y | 100 µg | ||
MO-AB-12436W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12436W | 100 µg | ||
MO-AB-17547Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17547Y | 100 µg | ||
MO-AB-19686R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19686R | 100 µg | ||
MO-AB-23698H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23698C | 100 µg | ||
MO-AB-28788H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28788C | 100 µg | ||
MO-AB-33214W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33214W | 100 µg | ||
MO-AB-42504W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42504W | 100 µg | ||
MO-AB-46417W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46417W | 100 µg | ||
MO-AB-63746W | Monoclonal | Marmoset | WB, ELISA | MO63746W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO57034FYA |
Specificity | This antibody binds to Rhesus S100A11. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. |
Product Overview | Mouse Anti-Rhesus S100A11 Antibody is a mouse antibody against S100A11. It can be used for S100A11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein S100; S100 calcium-binding protein; S100A11 |
UniProt ID | F6UGT9 |
Protein Refseq | The length of the protein is 105 amino acids long. The sequence is show below: MAKVSSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFINTELAAFTKNQKDPGVLDRIMKRLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry