Mouse Anti-S100A11 Antibody (CBMOAB-57034FYA)


Cat: CBMOAB-57034FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57034FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO57034FYA 100 µg
MO-AB-01310L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01310L 100 µg
MO-AB-07326W Monoclonal Cat (Felis catus) WB, ELISA MO07326W 100 µg
MO-AB-07389H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07389C 100 µg
MO-AB-09808Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09808Y 100 µg
MO-AB-12436W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12436W 100 µg
MO-AB-17547Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17547Y 100 µg
MO-AB-19686R Monoclonal Cattle (Bos taurus) WB, ELISA MO19686R 100 µg
MO-AB-23698H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23698C 100 µg
MO-AB-28788H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28788C 100 µg
MO-AB-33214W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33214W 100 µg
MO-AB-42504W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42504W 100 µg
MO-AB-46417W Monoclonal Horse (Equus caballus) WB, ELISA MO46417W 100 µg
MO-AB-63746W Monoclonal Marmoset WB, ELISA MO63746W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO57034FYA
SpecificityThis antibody binds to Rhesus S100A11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.
Product OverviewMouse Anti-Rhesus S100A11 Antibody is a mouse antibody against S100A11. It can be used for S100A11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein S100; S100 calcium-binding protein; S100A11
UniProt IDF6UGT9
Protein RefseqThe length of the protein is 105 amino acids long.
The sequence is show below: MAKVSSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFINTELAAFTKNQKDPGVLDRIMKRLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry