AibGenesis™ Mouse Anti-SAR1B Antibody (CBMOAB-41040FYC)
Cat: CBMOAB-41040FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-41040FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO41040FC | 100 µg | ||
| CBMOAB-97074FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97074FYA | 100 µg | ||
| MO-AB-07413H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07413C | 100 µg | ||
| MO-AB-19731R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19731R | 100 µg | ||
| MO-AB-23619W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23619W | 100 µg | ||
| MO-AB-28825H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28825C | 100 µg | ||
| MO-AB-28953R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28953R | 100 µg | ||
| MO-AB-43415W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43415W | 100 µg | ||
| MO-AB-46441W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46441W | 100 µg | ||
| MO-AB-63808W | Monoclonal | Marmoset | WB, ELISA | MO63808W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO41040FC |
| Specificity | This antibody binds to Arabidopsis SAR1B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus; Cytosol; Endoplasmic reticulum; Other locations; Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis SAR1B Antibody is a mouse antibody against SAR1B. It can be used for SAR1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Secretion Associated Ras Related GTPase 1B; GTP-Binding Protein B; SARA2; GTBPB; Secretion Associated, Ras Related GTPase 1B; SAR1a Gene Homolog (S. Cerevisiae) 2; SAR1a Gene Homolog 2 (S. Cerevisiae); SAR1 Homolog B (S. Cerevisiae); GTP-Binding Protein SAR1b |
| UniProt ID | Q01474 |
| Protein Refseq | The length of the protein is 193 amino acids long. The sequence is show below: MFLFDWFYGILASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry