Mouse Anti-SERPINH1 Antibody (CBMOAB-57499FYA)
Cat: CBMOAB-57499FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-57499FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Primat, Sheep (Ovis aries), Marmoset | WB, ELISA | MO57499FYA | 100 µg | ||
| MO-AB-07551H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07551C | 100 µg | ||
| MO-AB-17597Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17597Y | 100 µg | ||
| MO-AB-20001R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20001R | 100 µg | ||
| MO-AB-22961W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22961W | 100 µg | ||
| MO-AB-33282W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33282W | 100 µg | ||
| MO-AB-35655W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35655W | 100 µg | ||
| MO-AB-64168W | Monoclonal | Marmoset | WB, ELISA | MO64168W | 100 µg | ||
| MO-DKB-00918W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Dog (Canis lupus familiaris), Primat, Rhesus (Macaca mulatta), Sheep (Ovis aries) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Primat, Sheep (Ovis aries), Marmoset |
| Clone | MO57499FYA |
| Specificity | This antibody binds to Rhesus SERPINH1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The encoded protein is localized to the endoplasmic reticulum and plays a role in collagen biosynthesis as a collagen-specific molecular chaperone. Autoantibodies to the encoded protein have been found in patients with rheumatoid arthritis. Expression of this gene may be a marker for cancer, and nucleotide polymorphisms in this gene may be associated with preterm birth caused by preterm premature rupture of membranes. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. |
| Product Overview | Mouse Anti-Rhesus SERPINH1 Antibody is a mouse antibody against SERPINH1. It can be used for SERPINH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Serpin H1; SERPINH1 |
| UniProt ID | H9F200 |
| Protein Refseq | The length of the protein is 106 amino acids long. The sequence is show below: MHSLLLLSAFCLLAVALTAEVKKPAAAAAPGTAEKLSPKAATLAERSAGLAFSLYQAMAKDQAVENILVSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry