Mouse Anti-Sheep ACTB Antibody (MO-AB-14075Y)


Cat: MO-AB-14075Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO14075Y
SpecificityThis antibody binds to Sheep ACTB.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against ACTB. It can be used for ACTB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-actin; ACTB
UniProt IDH2E6Z4
Protein RefseqThe length of the protein is 32 amino acids long. The sequence is show below: NREKMTQIMFETFNTPAMYVAIQAVLSLYASG.

See other products for " ACTB "

MO-NAB-00305WMouse Anti-Zebrafish ACTB Antibody
MO-DKB-03645WRabbit Anti-ACTB Antibody (Cat MO-DKB-03645W)
MO-AB-10599YMouse Anti-O. mykiss ACTB Antibody (MO-AB-10599Y)
MO-AB-43566WMouse Anti-Horse ACTB Antibody (MO-AB-43566W)
MO-AB-23508RMouse Anti-Pig ACTB Antibody (MO-AB-23508R)
MO-AB-14073YMouse Anti-Sheep ACTB Antibody (MO-AB-14073Y)
MOFAB-381WRabbit Anti-Actb Antibody (MOFAB-381W)
MO-DKB-00322WRabbit Anti-ACTB Antibody (MO-DKB-00322W)
CBMOAB-35023FYAMouse Anti-Rhesus ACTB Antibody (CBMOAB-35023FYA)
MO-AB-28806WMouse Anti-Dog ACTB Antibody (MO-AB-28806W)
For Research Use Only | Not For Clinical Use.

Online Inquiry