Cat: MO-AB-14461Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries) |
| Clone | MO14461Y |
| Specificity | This antibody binds to Sheep CAT. |
| Format | Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against CAT. It can be used for CAT detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Catalase; EC 1.11.1.6; CAT |
| UniProt ID | C9DRI2 |
| Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: KRLCENIAGHLKDAQLFIQKKAVKNFSDVHPEYGSRIQALLDKYNEEKPKNAVHTYVQH. |
See other products for " Cat "
| MO-AB-41347W | Mouse Anti-Guinea pig Cat Antibody (MO-AB-41347W) |
| CBMOAB-69145FYA | Mouse Anti-Zebrafish cat Antibody (CBMOAB-69145FYA) |
| CBMOAB-69144FYA | Mouse Anti-Zebrafish cat Antibody (CBMOAB-69144FYA) |
| MO-AB-00176L | Mouse Anti-Elephant CAT Antibody (MO-AB-00176L) |
| MO-AB-29346W | Mouse Anti-Dog CAT Antibody (MO-AB-29346W) |
| MO-AB-00176R | Mouse Anti-Medaka cat Antibody (MO-AB-00176R) |
| MO-AB-24339R | Mouse Anti-Pig CAT Antibody (MO-AB-24339R) |
| MO-AB-43912W | Mouse Anti-Horse CAT Antibody (MO-AB-43912W) |
| MO-AB-23009H | Mouse Anti-Mallard CAT Antibody (MO-AB-23009H) |
| MOFAB-786W | Mouse Anti-CAT Antibody (MOFAB-786W) |
For Research Use Only | Not For Clinical Use.