Mouse Anti-Sheep CKS2 Antibody (MO-AB-14582Y)
Cat: MO-AB-14582Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries) |
| Clone | MO14582Y |
| Specificity | This antibody binds to Sheep CKS2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008] |
| Product Overview | This product is a mouse antibody against CKS2. It can be used for CKS2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cyclin-dependent kinases regulatory subunit; CKS2 |
| UniProt ID | W5PCX0 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MAHKQIYYSDKYFDEHYALPHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK. |
See other products for " cks2 "
| MO-AB-02428H | Mouse Anti-Frog cks2 Antibody (MO-AB-02428H) |
| MO-AB-24811H | Mouse Anti-Rat Cks2 Antibody (MO-AB-24811H) |
| MO-AB-24624R | Mouse Anti-Pig CKS2 Antibody (MO-AB-24624R) |
| CBMOAB-26186FYC | Mouse Anti-Arabidopsis CKS2 Antibody (CBMOAB-26186FYC) |
| MO-DKB-01313W | Rabbit Anti-CKS2 Antibody (MO-DKB-01313W) |
| MO-AB-12346W | Mouse Anti-Chimpanzee CKS2 Antibody (MO-AB-12346W) |
| MO-AB-10930Y | Mouse Anti-O. mykiss CKS2 Antibody (MO-AB-10930Y) |
| MO-AB-00218L | Mouse Anti-Elephant CKS2 Antibody (MO-AB-00218L) |
| MO-AB-23042H | Mouse Anti-Mallard CKS2 Antibody (MO-AB-23042H) |
| MO-AB-10274R | Mouse Anti-Cattle CKS2 Antibody (MO-AB-10274R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry