Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Sheep TP53 Antibody (MO-AB-18043Y)


Cat: MO-AB-18043Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO18043Y
SpecificityThis antibody binds to Sheep TP53.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TP53. It can be used for TP53 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative Namesp53; TP53
UniProt IDQ8WNX1
Protein RefseqThe length of the protein is 42 amino acids long. The sequence is show below: KTCPVQLWVDSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHE.

See other products for " TP53 "

MO-AB-10286YMouse Anti-Rabbit TP53 Antibody (MO-AB-10286Y)
MO-AB-15903WMouse Anti-Chimpanzee TP53 Antibody (MO-AB-15903W)
MO-AB-33799WMouse Anti-Dog TP53 Antibody (MO-AB-33799W)
MO-AB-33800WMouse Anti-Dog TP53 Antibody (MO-AB-33800W)
MO-AB-46888WMouse Anti-Horse TP53 Antibody (MO-AB-46888W)
CBMOAB-10406FYBMouse Anti-Zebrafish tp53 Antibody (CBMOAB-10406FYB)
MO-AB-66715WMouse Anti-Marmoset TP53 Antibody (MO-AB-66715W)
CBMOAB-60875FYAMouse Anti-Rhesus TP53 Antibody (CBMOAB-60875FYA)
CBMOAB-10409FYBMouse Anti-Zebrafish tp53 Antibody (CBMOAB-10409FYB)
MO-AB-10285YMouse Anti-Rabbit TP53 Antibody (MO-AB-10285Y)
For Research Use Only | Not For Clinical Use.

Online Inquiry