Mouse Anti-si:ch211-229d2.5 Antibody (CBMOAB-00039FYB)


Cat: CBMOAB-00039FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00039FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO00039FYB 100 µg
CBMOAB-61354FYC Monoclonal Zebrafish (Danio rerio) WB, ELISA MO61354FYC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO00039FYB
SpecificityThis antibody binds to Zebrafish si:ch211-229d2.5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish si:ch211-229d2.5 Antibody is a mouse antibody against si:ch211-229d2.5. It can be used for si:ch211-229d2.5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessi:ch211-229d2.5
UniProt IDF1RBQ2
Protein RefseqThe length of the protein is 355 amino acids long.
The sequence is show below: MKSMVDMVLLRLLILGTLVQPGYLGLTPASCGNNYRRPEITDIGVSCGTNSINLAIQACPVVYSGYNETLLILNQIANDPLCQGTLDANVTPPVVRFVFPIRQLDSCGSFFRTTSAAGTGAFSDFSNIQTVYISGVVRSFDPTMGTVTYNAELKYIYSCAYPLEYLINNTQVDVSASSIAVRDNNGSFISTLSMQLYKDINYTTPLVFPNGGIELRTRIFVQVIAVNLTSQYYVLLDRCYASISPVPSNSTYFNLFVPCNQDPMTSMLENGESQRARFSFPAFRFIEQQNQTVSTYYLHCITRLCETTTCPTFKQCRKRKRREVQTTTIKDGVSDATFITSGPITTRADTRMILF.
For Research Use Only | Not For Clinical Use.
Online Inquiry