Cat: MO-AB-69557W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Silkworm (Bombyx mori) |
Clone | MO69557W |
Specificity | This antibody binds to Silkworm CSP1. |
Format | Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Silkworm CSP1 (clone MO69557W) Antibody (MO-AB-69557W) is a mouse antibody against CSP1. It can be used for CSP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Chemosensory protein-1 variant; CSP1 |
UniProt ID | H9BXB1 |
Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: ADDKYTDKYDKINLQEILENKRLLESYMDCVLGKGKCTPEWKELKDHLQEAL. |
See other products for " CSP1 "
MO-AB-69552W | Mouse Anti-Silkworm CSP1 Antibody (MO-AB-69552W) |
MO-AB-69559W | Mouse Anti-Silkworm CSP1 Antibody (MO-AB-69559W) |
CBMOAB-26874FYC | Mouse Anti-Arabidopsis CSP1 Antibody (CBMOAB-26874FYC) |
MO-AB-69553W | Mouse Anti-Silkworm CSP1 Antibody (MO-AB-69553W) |
CBMOAB-02218HCB | Mouse Anti-C. elegans CSP1 Antibody (CBMOAB-02218HCB) |
CBMOAB-02220HCB | Mouse Anti-C. elegans CSP1 Antibody (CBMOAB-02220HCB) |
MO-AB-69555W | Mouse Anti-Silkworm CSP1 Antibody (MO-AB-69555W) |
CBMOAB-02219HCB | Mouse Anti-C. elegans CSP1 Antibody (CBMOAB-02219HCB) |
CBMOAB-14212FYA | Mouse Anti-D. melanogaster Csp1 Antibody (CBMOAB-14212FYA) |
MO-AB-69558W | Mouse Anti-Silkworm CSP1 Antibody (MO-AB-69558W) |
For Research Use Only | Not For Clinical Use.