Mouse Anti-slc25a10 Antibody (CBMOAB-05713FYB)


Cat: CBMOAB-05713FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05713FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO05713FYB 100 µg
MO-AB-10550W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10550W 100 µg
MO-AB-20277R Monoclonal Cattle (Bos taurus) WB, ELISA MO20277R 100 µg
MO-AB-64529W Monoclonal Marmoset WB, ELISA MO64529W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO05713FYB
SpecificityThis antibody binds to Zebrafish slc25a10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins that translocate small metabolites across the mitochondrial membrane. The encoded protein exchanges dicarboxylates, such as malate and succinate, for phosphate, sulfate, and other small molecules, thereby providing substrates for metabolic processes including the Krebs cycle and fatty acid synthesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product OverviewMouse Anti-Zebrafish slc25a10 Antibody is a mouse antibody against slc25a10. It can be used for slc25a10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSolute carrier family 25 (Mitochondrial carrier dicarboxylate transporter), member 10; slc25a1
UniProt IDQ7ZWA7
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: MAEKRMSRWYFGGIASCGAACCTHPLDLIKVHLQTQQEVKMRMMGMAIHVVKNDGFLALYSGLSASLCRQMSYSLTRFAIYETVRDTLGSGSQGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRMQNDVKLPLEQRRNYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAKQLVLGTGLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGEYRGVMHCLSETAKLGPLAFYKGLVPAGIRLIPHTILTFVFLEQLKKYFGIRVIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry