Mouse Anti-slc25a13 Antibody (CBMOAB-05720FYB)


Cat: CBMOAB-05720FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05720FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO05720FYB 100 µg
MO-AB-06036W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06036W 100 µg
MO-AB-07692H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07692C 100 µg
MO-AB-10413W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10413W 100 µg
MO-AB-30070R Monoclonal Pig (Sus scrofa) WB, ELISA MO30070R 100 µg
MO-AB-64535W Monoclonal Marmoset WB, ELISA MO64535W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO05720FYB
SpecificityThis antibody binds to Zebrafish slc25a13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton across the inner mitochondrial membrane, and is stimulated by calcium on the external side of the inner mitochondrial membrane. Mutations in this gene result in citrullinemia, type II. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish slc25a13 Antibody is a mouse antibody against slc25a13. It can be used for slc25a13 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesslc25a13; Solute Carrier Family 25 Member 13
UniProt IDF1R0X3
Protein RefseqThe length of the protein is 667 amino acids long.
The sequence is show below: VCLCLQVMIKRADPAELKFIFLKYASVEKNGERYMSPEDFVFKFLHAQTDIWLSKDSAVLLTGVLDQTKDGLISFQEFLAFESVLCAPDALFMVAFQLFDKTGNGIATFEDVKQVFTQTTIHQHIPFNWNSEFVQLHFGADRKKHLNYGEFTQFLLEMQLEHARQAFVQRDKAKSGTITALDFRDIMVTIRPHMLTRFVEESLVAAAGGSTAHQVSFSYFNGFNSLLNNMELIRKIYTTLAGNRRDVEVTKEEFIIAAQRFGQVTPMEVDILFQLADLSEPRGRLGLVDIEMIAPLEEGALPYNLAEIQRQHSGGEASRSVLIQAAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRSSGSLVEELMYKNSLDCFKKVVRYEGFFGLYRGLVPQLLGVAPEKAIKLTVNDFVRGKTLQKDGSVPLPAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSAFSVIRDLGFFGLYKGAKACFLRDIPFSAIYFPCYAHTKAALTDEDGRVGPGRLLLAGALAGMPAASLVTPADVIKTRLQVAARAGQTTYNGLIDCFWKILQEEGPRAFWKGAGEKFFKILNDFLLLLKTHFKIKELYYNSFTFEKPAGAEPTPKSRISLPAPNPDHIGGFRLAVATFAGIESKFGLHLPRFQASAGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry