Mouse Anti-slc25a24 Antibody (CBMOAB-05749FYB)


Cat: CBMOAB-05749FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05749FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO05749FYB 100 µg
CBMOAB-58045FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58045FYA 100 µg
MO-AB-06037W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06037W 100 µg
MO-AB-09959Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09959Y 100 µg
MO-AB-20245W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20245W 100 µg
MO-AB-20292R Monoclonal Cattle (Bos taurus) WB, ELISA MO20292R 100 µg
MO-AB-64549W Monoclonal Marmoset WB, ELISA MO64549W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO05749FYB
SpecificityThis antibody binds to Zebrafish slc25a24.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a carrier protein that transports ATP-Mg exchanging it for phosphate. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish slc25a24 Antibody is a mouse antibody against slc25a24. It can be used for slc25a24 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcium-binding mitochondrial carrier protein SCaMC-1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24; slc25a24; scamc
UniProt IDQ66L49
Protein RefseqThe length of the protein is 477 amino acids long.
The sequence is show below: MHQLIRKFVFTESHCLEEEDNTKSFAELFEKLDVNKDGKVDVSELKTGLAAMGFSMGKGEAQKIVTSGDTDKDEGLDFEEFSKYLKEHEKKLRLTFKSLDKNEDGRVDAKEIQQSLKDLGINLSDKDAEKILHSIDVDGTMTLDWNEWREHFLFNPAEDLQQIIRYWKKSTVLDIGDSLTIPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFKQMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSKDGGKVQSHERFMAGSLAGATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAGIDLAVYETLKNTWLSHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAMASMEGSEQVSMSKLVKKIMQKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGISK.
For Research Use Only | Not For Clinical Use.
Online Inquiry