Mouse Anti-slc25a43 Antibody (CBMOAB-05802FYB)


Cat: CBMOAB-05802FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-05802FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO05802FYB 100 µg
CBMOAB-58073FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58073FYA 100 µg
MO-AB-14214W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14214W 100 µg
MO-AB-64573W Monoclonal Marmoset WB, ELISA MO64573W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO05802FYB
SpecificityThis antibody binds to Zebrafish slc25a43.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the mitochondrial carrier family of proteins.
Product OverviewMouse Anti-Zebrafish slc25a43 Antibody is a mouse antibody against slc25a43. It can be used for slc25a43 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSolute carrier family 25 member 43; slc25a4
UniProt IDQ5U3V7
Protein RefseqThe length of the protein is 345 amino acids long.
The sequence is show below: MATVKKDARLTSSQSLMCVGFAGIFSKTVTSPLEVVKILSQVGTFHCKRGFLHSFVLICQNEGLRAFWKGNMVSCLRLFPYSAIHLATYKNIVNLHIDELGDISQWRAIVAGGLAGISAALATYPLEVVETRLIAQNCQEPTYRGLLHSLSVIYRNEGLQALYRGFSLTVLGAVPFSVGCYAVYINLDKLWQERHVRFTSLQNFINGCLAAGVAQTLSFPFETVKKKMQAQSLVLPHCGGVDVHFNGMADCFRQVIKNKGVMALWSGLTANMVKIVPYFGLLFSCFEMCKQVCLYRNGYIISPPSYKLKPGVDQSLGPYELQEFKRYLRNRKSHKAQSSSIGNRW.
For Research Use Only | Not For Clinical Use.
Online Inquiry