Mouse Anti-SMCP Antibody (CBMOAB-58526FYA)


Cat: CBMOAB-58526FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58526FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO58526FYA 100 µg
MO-AB-20586R Monoclonal Cattle (Bos taurus) WB, ELISA MO20586R 100 µg
MO-AB-29017H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29017C 100 µg
MO-AB-30250R Monoclonal Pig (Sus scrofa) WB, ELISA MO30250R 100 µg
MO-AB-33454W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33454W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO58526FYA
SpecificityThis antibody binds to Rhesus SMCP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath.
Product OverviewMouse Anti-Rhesus SMCP Antibody is a mouse antibody against SMCP. It can be used for SMCP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSMCP
UniProt IDF7F3V9
Protein RefseqThe length of the protein is 123 amino acids long.
The sequence is show below: MCDQPKHSQCCPAKDNQCCPSKQNQCSQPKGNQCCPPKQNQCCQPKGNQCCPPKHNHCCQPKPPCCIKARCCSLETKPECSPLNVESEPNSPQTQDKGSQTQQQPYSPQNKSSPSKWEQKSNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry