Mouse Anti-snrpa1 Antibody (CBMOAB-06712FYB)


Cat: CBMOAB-06712FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06712FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06712FYB 100 µg
MO-AB-07885H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07885C 100 µg
MO-AB-20668R Monoclonal Cattle (Bos taurus) WB, ELISA MO20668R 100 µg
MO-AB-26099W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26099W 100 µg
MO-AB-29075H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29075C 100 µg
MO-AB-65004W Monoclonal Marmoset WB, ELISA MO65004W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO06712FYB
SpecificityThis antibody binds to Zebrafish snrpa1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSNRPA1 (Small Nuclear Ribonucleoprotein Polypeptide A') is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression.
Product OverviewMouse Anti-Zebrafish snrpa1 Antibody is a mouse antibody against snrpa1. It can be used for snrpa1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessnrpa1; Small Nuclear Ribonucleoprotein Polypeptide A'
UniProt IDF1R300
Protein RefseqThe length of the protein is 277 amino acids long.
The sequence is show below: MVKLTAELIEQAAQYTNPVRDRELDLRGYKIPVLENLGATLDQFDTIDLSDNEVRKLDGFPLLKRLKTLLVNNNRICRIGENLEQALPDLKELILTSNNIQELGDLDPLATVKSLSLLSLLRNPVTNKKHYRLYVINKIPQIRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIAKQSKTFTPGAGLQTEKKTGPSAAEVEAIKNAIANATSLAEVERLKGLLQAGQIPGRDLRSGAGNMVEEEEEEEMSESVPMFEDMQGENNDEDMQEEMHVNGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry