Mouse Anti-snrpc Antibody (CBMOAB-06719FYB)
Cat: CBMOAB-06719FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-06719FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Gorilla, Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO06719FYB | 100 µg | ||
MO-AB-01437L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01437L | 100 µg | ||
MO-AB-01629R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01629R | 100 µg | ||
MO-AB-10050Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10050Y | 100 µg | ||
MO-AB-13280Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13280Y | 100 µg | ||
MO-AB-17744Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17744Y | 100 µg | ||
MO-AB-20673R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20673R | 100 µg | ||
MO-AB-21153W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21153W | 100 µg | ||
MO-AB-29080H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29080C | 100 µg | ||
MO-AB-30286R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30286R | 100 µg | ||
MO-AB-33473W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33473W | 100 µg | ||
MO-AB-33815H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33815C | 100 µg | ||
MO-AB-38767W | Monoclonal | Gorilla | WB, ELISA | MO38767W | 100 µg | ||
MO-AB-65012W | Monoclonal | Marmoset | WB, ELISA | MO65012W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Gorilla, Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO06719FYB |
Specificity | This antibody binds to Zebrafish snrpc. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant. |
Product Overview | Mouse Anti-Zebrafish snrpc Antibody is a mouse antibody against snrpc. It can be used for snrpc detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | U1 small nuclear ribonucleoprotein C; U1 snRNP C; U1-C; U1C; snrp |
UniProt ID | Q8JGS0 |
Protein Refseq | The length of the protein is 159 amino acids long. The sequence is show below: MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFPGAPPPGGSLLPHPSIGGPPRPGMLPAPPMGGPPMMPMMGPPPHAMMPGGPGPGMRPPMGGPMQMMPGPHMMRPPARPMMPAVRPGMVRPDR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry