Mouse Anti-snx17 Antibody (CBMOAB-06765FYB)


Cat: CBMOAB-06765FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06765FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06765FYB 100 µg
CBMOAB-10023HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO10023HB 100 µg
MO-AB-07907H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07907C 100 µg
MO-AB-18582W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18582W 100 µg
MO-AB-20698R Monoclonal Cattle (Bos taurus) WB, ELISA MO20698R 100 µg
MO-AB-29097H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29097C 100 µg
MO-AB-65047W Monoclonal Marmoset WB, ELISA MO65047W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO06765FYB
SpecificityThis antibody binds to Zebrafish snx17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a B41 domain. This protein interacts with the cytoplasmic domain of P-selectin, and may function in the intracellular trafficking of P-selectin. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Zebrafish snx17 Antibody is a mouse antibody against snx17. It can be used for snx17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSorting nexin-17; snx17; NP_001038622.
UniProt IDQ5RID7
Protein RefseqThe length of the protein is 473 amino acids long.
The sequence is show below: MHFSIPETEVRSDENGSSYVAYNIHVNGVLHCRVRYSQLLGLHEQIKKEYGNNVVPAFPPKKIFTLTPAEVDQRREQLEKYMQAVRQDPILGSSEMFNSFLRKAQQETQQIPTEEVQLEIYLSNGQKVKVNILTSDQTEDVLEAVASKLDLPDELVGYFSLFLVQERADGSCTYVRKLQEFELPYVSITSLHSSDYRIILRKSYWDTAYDSDVMDDRVGLNLLYAQTVSDIDRGWILVNKEQHRQLKSLQEKGSKKEFIRLAQTLKYYGYIKFDPCITDFPEKGCHVIVGAGNNELNFHVKLPNEQMKEGSFKVTRMRCWRVTSSQVPVANGTANPSSSSKCDVKLELAFEYLMSKDRLQWVTITSQQAIMMSICLQSMVDELMVKKSGGSIKKQMQKKRLNGSLQRSDSQQAVKSPPILDSPDPNREQVVKLSTKLSSVSLRGLSSSNSAGDISGNDFHGNYAFEGIGDDDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry