Mouse Anti-socs4 Antibody (CBMOAB-06838FYB)


Cat: CBMOAB-06838FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06838FYB Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes) WB, ELISA MO06838FYB 100 µg
CBMOAB-58724FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58724FYA 100 µg
MO-AB-01636R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01636R 100 µg
MO-AB-04085Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04085Y 100 µg
MO-AB-11760W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11760W 100 µg
MO-AB-30306R Monoclonal Pig (Sus scrofa) WB, ELISA MO30306R 100 µg
MO-AB-65083W Monoclonal Marmoset WB, ELISA MO65083W 100 µg
MO-DKB-01109W Polyclonal Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes)
CloneMO06838FYB
SpecificityThis antibody binds to Zebrafish socs4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS), also known as STAT-induced STAT inhibitor (SSI), protein family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish socs4 Antibody is a mouse antibody against socs4. It can be used for socs4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuppressor of cytokine signaling 4a; socs4; socs4
UniProt IDL0N914
Protein RefseqThe length of the protein is 380 amino acids long.
The sequence is show below: MSERKTKNSDTRPKNLRSWSADSYIRSIKKRSRGSRHETAPRGEEGDGADEQTARSASCPRRRRERMCSCTIPGETDSDSPCRKALSRRSLRQKFQDAVGQCLPLRNHHHHHHHSSGSSRPFSVLLWSKRKIHVSELMEDKCPFSPKSELAQCWHLIKKHGTNTKPSLSIETEPKGPLLSSTPPTLLSWEQIGSTGASSLDDWDPSFALGDSQCCAHTDYILVPDLLQINNSPCYWGVLDRFEAEQLLEGQPEGTFLLRDSAQDEYLFSVSFRRYSRSLHARIEQNGKRFSFDGRDPCMYRDSSVTGLLKHYSDPSTCLFFEPLLSRPLPRNFPFTLQHLCRAVICSCTTYQGIEALPLPYTLRHFLRQYHYRCNGACAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry