Mouse Anti-sord Antibody (CBMOAB-06897FYB)


Cat: CBMOAB-06897FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06897FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Sheep (Ovis aries) WB, ELISA MO06897FYB 100 µg
MO-AB-07930H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07930C 100 µg
MO-AB-10307W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10307W 100 µg
MO-AB-17753Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17753Y 100 µg
MO-AB-20740R Monoclonal Cattle (Bos taurus) WB, ELISA MO20740R 100 µg
MO-AB-42621W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42621W 100 µg
MO-AB-65106W Monoclonal Marmoset WB, ELISA MO65106W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Sheep (Ovis aries)
CloneMO06897FYB
SpecificityThis antibody binds to Zebrafish sord.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.
Product OverviewMouse Anti-Zebrafish sord Antibody is a mouse antibody against sord. It can be used for sord detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessord; Sorbitol Dehydrogenase
UniProt IDF1Q713
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: MDKDNLSVVLHAKGDLRLEQRPIPEPGPNDVLLQMHSVGICGSDVHYWQNGRIGDFVVKQPMILGHEASGRVVKVGSAVTHLKPGDRVAVEPGVPREVDEFVKSGHYNLSPSIFFCATPPDDGNLCRYYKHSASFCYKLPDNVTYEEGALIEPLSVGIHACRRAGVTLGSSVFVCGAGPIGLVSLLAAKAMGASQVIISDLSSDRLAKAKEIGADFLLPVKKEDSPQDLAKRVEGMLGCMPQICIECTGVQSSIQTAIYATRSGGVVVSVGLGAEMTTVPLLNAAVREVDIRGVFRYCNTWPVAISMLASKKVNVKPLVTHRFPLEHAVQAFETTRQGLGVKVMLKCDKNDQNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry