Mouse Anti-Soybean ABCC5 Antibody (MO-AB-30980H)


Cat: MO-AB-30980H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max)
CloneMO30980C
SpecificityThis antibody binds to Soybean ABCC5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against ABCC5. It can be used for ABCC5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABC transporter; ABCC5
UniProt IDU3MXB9
Protein RefseqThe length of the protein is 173 amino acids long.
The sequence is show below: EAIEAMDIPTHSEDSDENLSLEACVMTSKKSICSANDIDSLAKEVQEGSSISDQKAIKEKKKAKRSRKKQLVQEEERIRGRVSMKVYLSYMAAAYKGLLIPLIIIAQTLFQFLQIASNWWMAWANPQTEGDLPKVTPSVLLLVYMALAFGSSWFIFVRAVLVATFGLAAAQKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry