Mouse Anti-Soybean ACS Antibody (MO-AB-30997H)


Cat: MO-AB-30997H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max)
CloneMO30997C
SpecificityThis antibody binds to Soybean ACS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the conversion of acetate into acetyl-CoA (AcCoA), an essential intermediate at the junction of anabolic and catabolic pathways. Acs undergoes a two-step reaction. In the first half reaction, Acs combines acetate with ATP to form acetyl-adenylate (AcAMP) intermediate. In the second half reaction, it can then transfer the acetyl group from AcAMP to the sulfhydryl group of CoA, forming the product AcCoA.
Product OverviewThis product is a mouse antibody against ACS. It can be used for ACS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1-aminocyclopropane-1-carboxylate synthase; ACS
UniProt IDQ27ZJ4
Protein RefseqThe length of the protein is 484 amino acids long.
The sequence is show below: MGLMAANQTQLLSKMAIGDGHGEASPYFDGWKAYDENPFHPKENPNGVIQMGLAENQLTSDLVEDWILNNPEASICTPEGINDFRAIANFQDYHGLPEFRNAVAKFMGRTRGNRVTFDPDRIVMSGGATGAHEVTTFCLADPGDAFLVPIPYYPGFDRDLRWRTGIKLVPVMCDSSNNFKLTKQALEDAYVKAKEDNIRVKGMLITNPSNPLGTVMDRNTLRTVVSFINEKRIHLVSHEIYSATVFSRPSFISIAEILEEDTDIECDRNLVHIVYSLSKDMGFPGFRVGIIYSYNDAVVNCARKMSSFGLVSTQTQHLLASMLNDDEFVERFLEESAKRLAQRHRVFTSGLAKVGIKCLQSNAGLFVWMDLRQLLKKPTLDSEMELWRVIIHEVKINVSPGSSFHCTEPGWFRVCYANMDDMAVQIALQRIRTFVLQNKEVMVPNKKHCWHSNLRLSLKTXRFDDIMMSPHSPIPQSPLVKATI.
For Research Use Only | Not For Clinical Use.
Online Inquiry