Mouse Anti-spry4 Antibody (CBMOAB-07229FYB)


Cat: CBMOAB-07229FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07229FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO07229FYB 100 µg
CBMOAB-58991FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58991FYA 100 µg
MO-AB-04129Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04129Y 100 µg
MO-AB-06245W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06245W 100 µg
MO-AB-20298W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20298W 100 µg
MO-AB-20856R Monoclonal Cattle (Bos taurus) WB, ELISA MO20856R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO07229FYB
SpecificityThis antibody binds to Zebrafish spry4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of cysteine- and proline-rich proteins. The encoded protein is an inhibitor of the receptor-transduced mitogen-activated protein kinase (MAPK) signaling pathway. Activity of this protein impairs the formation of active GTP-RAS. Nucleotide variation in this gene has been associated with hypogonadotropic hypogonadism 17 with or without anosmia. Alternative splicing results in a multiple transcript variants.
Product OverviewMouse Anti-Zebrafish spry4 Antibody is a mouse antibody against spry4. It can be used for spry4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSprouty4; Spry4 protein; spry4; sprouty
UniProt IDQ90XH4
Protein RefseqThe length of the protein is 310 amino acids long.
The sequence is show below: MESRVPHHIPGVSSSIMVQPLLDSRVPYGRLQHPLTVYPIDQMKALHLENDYIDTPAVISQQPPSHKANPRGQEVLLGAPHHPNLSRCEVPDATTHPWISFSGRPSSISSSSSTSSDQRLLDHAAPTPVVDPYTTGNSHGRTLAAEQPKILSSKNIKTLAALPEEKKKHVLLCEKCGKCRCTECTLPRTLPSCWVCNQECLCSAQNLVDSVTCMCLVKGVFYHCTDEDEEGSCADKPCSCSHSNCCARWSFMAAVSLVLPCLVCYLPATGCAKLSQKCYDGVSRPGCRCKSTQSCKVAEIKACQPEKQAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry